- Recombinant Drosophila pseudoobscura pseudoobscura Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 4 homolog (GA24324)
- MyBioSource.com
- Pricing InfoSupplier PageView Company Product Page
- MBS1164507
- 1 mg (E Coli Derived)
- This item requires custom production and lead time is between 5-9 weeks. We can custom produce according to your specifications
- >90%
- Recombinant Protein
- 4,384 Da
- E Coli or Yeast
- 14611
- GA24324, dpse_GLEANR_14313
- Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 4 homolog (GA24324)
Sequence
MITDVQLAIFSNVLGVFLFLLVVAYHYINANTGKSSPKAK